Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 13 (CA XIII)
LigandBDBM10883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_753081
Ki 23±n/a nM
Citation Biswas SAggarwal MGüzel Scozzafava AMcKenna RSupuran CT Conformational variability of different sulfonamide inhibitors with thienyl-acetamido moieties attributes to differential binding in the active site of cytosolic human carbonic anhydrase isoforms. Bioorg Med Chem 19:3732-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 13 (CA XIII)
Name:Carbonic anhydrase 13 (CA XIII)
Synonyms:Carbonic anhydrase XIII (CA XIII)
Type:Enzyme
Mol. Mass.:29445.78
Organism:Homo sapiens (Human)
Description:Q8N1Q1
Residue:262
Sequence:
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10883
n/a
NameBDBM10883
Synonyms:4,5-dichlorobenzene-1,3-disulfonamide | CHEMBL17 | Dichlorophenamide | Dichlorophenamide (DCP) | Dichlorophenamide, DCP | Sulfonamide, 4 | US10172837, Dichlorphenamide | sulfonamide 4
TypeSmall organic molecule
Emp. Form.C6H6Cl2N2O4S2
Mol. Mass.305.159
SMILESNS(=O)(=O)c1cc(Cl)c(Cl)c(c1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: