Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose 5-phosphate reductoisomerase
LigandBDBM50181153
Substrate/Competitorn/a
Meas. Tech.ChEMBL_755773
Ki 130±n/a nM
Citation Deng LDiao JChen PPujari VYao YCheng GCrick DCPrasad BVSong Y Inhibition of 1-deoxy-D-xylulose-5-phosphate reductoisomerase by lipophilic phosphonates: SAR, QSAR, and crystallographic studies. J Med Chem 54:4721-34 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Name:1-deoxy-D-xylulose 5-phosphate reductoisomerase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42846.92
Organism:Mycobacterium tuberculosis
Description:ChEMBL_1474510
Residue:413
Sequence:
MTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRAQ
TGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTG
ARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVV
VHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGAAAACDFHTASSWEFEP
LDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQ
WAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAGRHASTLERS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181153
n/a
NameBDBM50181153
Synonyms:3-(N-hydroxyacetamido)propylphosphonic acid | 3-(N-hydroxyformamido)propylphosphonic acid | CHEMBL205338 | FR-900098 | ammonium 3-(N-hydroxyacetamido)propylphosphonate
TypeSmall organic molecule
Emp. Form.C5H12NO5P
Mol. Mass.197.1262
SMILESCC(=O)N(O)CCCP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: