| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinol-binding protein 4 |
|---|
| Ligand | BDBM50092055 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_756077 (CHEMBL1804187) |
|---|
| EC50 | 2372±n/a nM |
|---|
| Citation |  Campos-Sandoval, JA; Redondo, C; Kinsella, GK; Pal, A; Jones, G; Eyre, GS; Hirst, SC; Findlay, JB Fenretinide derivatives act as disrupters of interactions of serum retinol binding protein (sRBP) with transthyretin and the sRBP receptor. J Med Chem54:4378-87 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinol-binding protein 4 |
|---|
| Name: | Retinol-binding protein 4 |
|---|
| Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23008.75 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P02753 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
|---|
| BDBM50092055 |
|---|
| n/a |
|---|
| Name | BDBM50092055 |
|---|
| Synonyms: | (2E,4E,6E,8E)-3,7-Dimethyl-9-(2,6,6-trimethyl-cyclohex-1-enyl)-nona-2,4,6,8-tetraenoic acid (4-hydroxy-phenyl)-amide | (2E,4E,6E,8E)-N-(4-hydroxyphenyl)-3,7-dimethyl-9-(2,6,6-trimethylcyclohex-1-enyl)nona-2,4,6,8-tetraenamide | 3,7-Dimethyl-9-(2,6,6-trimethyl-cyclohex-1-enyl)-nona-2,4,6,8-tetraenoic acid (4-hydroxy-phenyl)-amide | 4-hydroxyphenyl retinamide | CHEMBL7301 | FENRETINIDE | N-(4-HYDROXYPHENYL)ALL-TRANS RETINAMIDE | N-(4-hydroxyphenyl)-retinamide | N-(4-hydroxyphenyl)retinamide | N-(4-hydroxyphenyl)retinamide, 4-HPR |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H33NO2 |
|---|
| Mol. Mass. | 391.5457 |
|---|
| SMILES | C\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(=O)Nc1ccc(O)cc1 |c:4| |
|---|
| Structure | 
|
|---|
Search and Browse
