Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEctonucleotide pyrophosphatase/phosphodiesterase family member 2
LigandBDBM50347724
Substrate/Competitorn/a
Meas. Tech.ChEMBL_756213
IC50 7.3±n/a nM
Citation Albers HMHendrickx LJvan Tol RJHausmann JPerrakis AOvaa H Structure-based design of novel boronic acid-based inhibitors of autotaxin. J Med Chem 54:4619-26 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
Name:Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
Synonyms:ATX | Autotaxin | Autotaxin (ATX) | E-NPP 2 | ENPP2 | Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2) | Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 (E-NPP2) | Extracellular lysophospholipase D | LysoPLD | PDNP2
Type:Enzyme
Mol. Mass.:99007.13
Organism:Homo sapiens (Human)
Description:Q13822
Residue:863
Sequence:
MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYG
RPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVS
PSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVL
VKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQ
PADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR
KTSRSYPEILTLKTYLHTYESEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50347724
n/a
NameBDBM50347724
Synonyms:CHEMBL1802519
TypeSmall organic molecule
Emp. Form.C25H21BFNO5
Mol. Mass.445.247
SMILESOB(O)c1ccc(COc2ccc(\C=C3/CC(=O)N(Cc4ccc(F)cc4)C3=O)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: