Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 2
LigandBDBM50347744
Substrate/Competitorn/a
Meas. Tech.ChEMBL_756287
IC50 47±n/a nM
Citation Debdab MCarreaux FRenault SSoundararajan MFedorov OFilippakopoulos PLozach OBabault LTahtouh TBaratte BOgawa YHagiwara MEisenreich ARauch UKnapp SMeijer LBazureau JP Leucettines, a class of potent inhibitors of cdc2-like kinases and dual specificity, tyrosine phosphorylation regulated kinases derived from the marine sponge leucettamine B: modulation of alternative pre-RNA splicing. J Med Chem 54:4172-86 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 2
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66690.69
Organism:Homo sapiens (Human)
Description:ChEMBL_1508025
Residue:601
Sequence:
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50347744
n/a
NameBDBM50347744
Synonyms:CHEMBL1803083
TypeSmall organic molecule
Emp. Form.C15H15N3O3
Mol. Mass.285.2979
SMILESO=C1NC(NCC2CC2)=NC1=Cc1ccc2OCOc2c1 |w:11.13,c:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: