| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM50347746 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_756293 (CHEMBL1805106) |
|---|
| IC50 | 1200±n/a nM |
|---|
| Citation |  Debdab, M; Carreaux, F; Renault, S; Soundararajan, M; Fedorov, O; Filippakopoulos, P; Lozach, O; Babault, L; Tahtouh, T; Baratte, B; Ogawa, Y; Hagiwara, M; Eisenreich, A; Rauch, U; Knapp, S; Meijer, L; Bazureau, JP Leucettines, a class of potent inhibitors of cdc2-like kinases and dual specificity, tyrosine phosphorylation regulated kinases derived from the marine sponge leucettamine B: modulation of alternative pre-RNA splicing. J Med Chem54:4172-86 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM50347746 |
|---|
| n/a |
|---|
| Name | BDBM50347746 |
|---|
| Synonyms: | CHEMBL1803085 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H13N3O4 |
|---|
| Mol. Mass. | 323.3028 |
|---|
| SMILES | Oc1ccc(NC2=NC(=Cc3ccc4OCOc4c3)C(=O)N2)cc1 |w:9.9,t:6| |
|---|
| Structure | 
|
|---|
Search and Browse
