Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
LigandBDBM50347757
Substrate/Competitorn/a
Meas. Tech.ChEMBL_756286
IC50 390±n/a nM
Citation Debdab MCarreaux FRenault SSoundararajan MFedorov OFilippakopoulos PLozach OBabault LTahtouh TBaratte BOgawa YHagiwara MEisenreich ARauch UKnapp SMeijer LBazureau JP Leucettines, a class of potent inhibitors of cdc2-like kinases and dual specificity, tyrosine phosphorylation regulated kinases derived from the marine sponge leucettamine B: modulation of alternative pre-RNA splicing. J Med Chem 54:4172-86 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Name:Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Synonyms:Dual specificity tyrosine-phosphorylation-regulated kinase 1A
Type:Enzyme Catalytic Domain
Mol. Mass.:85573.59
Organism:RAT
Description:Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A 0 RAT::Q63470
Residue:763
Sequence:
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFAAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50347757
n/a
NameBDBM50347757
Synonyms:CHEMBL1802844
TypeSmall organic molecule
Emp. Form.C15H17N3O3
Mol. Mass.287.3138
SMILESCC(C)NC1=NC(=Cc2ccc3OCOc3c2)C(=O)N1C |w:7.7,t:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: