Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50171296
Substrate/Competitorn/a
Meas. Tech.ChEMBL_757148
Ki>1000±n/a nM
Citation Martín-Couce LMartín-Fontecha MCapolicchio SLópez-Rodríguez MLOrtega-Gutiérrez S Development of endocannabinoid-based chemical probes for the study of cannabinoid receptors. J Med Chem 54:5265-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50171296
n/a
NameBDBM50171296
Synonyms:2-[((11Z,14Z)-Icosa-5,8,11,14-tetraenyl)oxy]-propane-1,3-diol | 2-[((5Z,8Z,11Z)-Icosa-5,8,11,14-tetraenyl)oxy]-propane-1,3-diol | 2-[(5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenyloxy]propane-1,3-diol | CHEMBL146346 | HU-310
TypeSmall organic molecule
Emp. Form.C23H40O3
Mol. Mass.364.5619
SMILESCCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCCOC(CO)CO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: