Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase IV
LigandBDBM50348621
Substrate/Competitorn/a
Meas. Tech.ChEMBL_755602
IC50>10000±n/a nM
Citation Belanger DBCurran PJHruza AVoigt JMeng ZMandal AKSiddiqui MABasso ADGray K Discovery of imidazo[1,2-a]pyrazine-based Aurora kinase inhibitors. Bioorg Med Chem Lett 20:5170-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase IV
Name:CaM kinase IV
Synonyms:CAM kinase-GR | CAMK4 | CaMK IV | Calcium/calmodulin-dependent protein kinase type IV
Type:PROTEIN
Mol. Mass.:51919.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1459854
Residue:473
Sequence:
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50348621
n/a
NameBDBM50348621
Synonyms:CHEMBL1270795
TypeSmall organic molecule
Emp. Form.C14H13N7S2
Mol. Mass.343.43
SMILESCSc1cn2c(cnc2c(Nc2cc(C)ns2)n1)-c1cn[nH]c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: