| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Corticotropin-releasing factor receptor 1 |
|---|
| Ligand | BDBM50348782 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_758166 (CHEMBL1809497) |
|---|
| Ki | 9.8±n/a nM |
|---|
| Citation |  Hodgetts, KJ; Ge, P; Yoon, T; De Lombaert, S; Brodbeck, R; Gulianello, M; Kieltyka, A; Horvath, RF; Kehne, JH; Krause, JE; Maynard, GD; Hoffman, D; Lee, Y; Fung, L; Doller, D Discovery of N-(1-ethylpropyl)-[3-methoxy-5-(2-methoxy-4-trifluoromethoxyphenyl)-6-methyl-pyrazin-2-yl]amine 59 (NGD 98-2): an orally active corticotropin releasing factor-1 (CRF-1) receptor antagonist. J Med Chem54:4187-206 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Corticotropin-releasing factor receptor 1 |
|---|
| Name: | Corticotropin-releasing factor receptor 1 |
|---|
| Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 47870.75 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Receptor binding assays were performed using rat cortex homogenate. |
|---|
| Residue: | 415 |
|---|
| Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
|---|
| BDBM50348782 |
|---|
| n/a |
|---|
| Name | BDBM50348782 |
|---|
| Synonyms: | CHEMBL1807053 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H24F3N3O3 |
|---|
| Mol. Mass. | 399.4074 |
|---|
| SMILES | CCC(CC)Nc1nc(C)c(nc1OC)-c1ccc(OC(F)(F)F)cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
