| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymase |
|---|
| Ligand | BDBM50349183 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_759674 (CHEMBL1811418) |
|---|
| IC50 | 640±n/a nM |
|---|
| Citation |  Lo, HY; Nemoto, PA; Kim, JM; Hao, MH; Qian, KC; Farrow, NA; Albaugh, DR; Fowler, DM; Schneiderman, RD; Michael August, E; Martin, L; Hill-Drzewi, M; Pullen, SS; Takahashi, H; De Lombaert, S Benzimidazolone as potent chymase inhibitor: modulation of reactive metabolite formation in the hydrophobic (P1) region. Bioorg Med Chem Lett21:4533-9 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymase |
|---|
| Name: | Chymase |
|---|
| Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27340.12 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 247 |
|---|
| Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
|---|
| BDBM50349183 |
|---|
| n/a |
|---|
| Name | BDBM50349183 |
|---|
| Synonyms: | CHEMBL1807538 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21N3O3 |
|---|
| Mol. Mass. | 363.4097 |
|---|
| SMILES | Cc1cn(C)c2c(Cn3c4ccccc4n(CCC(O)=O)c3=O)cccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
