Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 2
LigandBDBM19130
Substrate/Competitorn/a
Meas. Tech.ChEMBL_761695
IC50 4±n/a nM
Citation Whitehead LDobler MRRadetich BZhu YAtadja PWClaiborne TGrob JEMcRiner APancost MRPatnaik AShao WShultz MTichkule RTommasi RAVash BWang PStams T Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors. Bioorg Med Chem 19:4626-34 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 2
Name:Histone deacetylase 2
Synonyms:HD2 | HDAC2 | Histone deacetylase 2 (HDAC2) | Human HDAC2
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:55356.54
Organism:Homo sapiens (Human)
Description:Q92769
Residue:488
Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19130
n/a
NameBDBM19130
Synonyms:(2E,4E,6R)-7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxohepta-2,4-dienamide | CHEMBL99 | TSA | Trichostatin A (TSA)
TypeSmall organic molecule
Emp. Form.C17H22N2O3
Mol. Mass.302.3682
SMILESCC(C=CC(=O)NO)C=C(C)C(=O)c1ccc(cc1)N(C)C |w:8.7,2.1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: