Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArginase-1
LigandBDBM50350310
Substrate/Competitorn/a
Meas. Tech.ChEMBL_762137
Kd 3.4E4±n/a nM
Citation Ilies MDi Costanzo LDowling DPThorn KJChristianson DW Binding ofa,a-disubstituted amino acids to arginase suggests new avenues for inhibitor design. J Med Chem 54:5432-43 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arginase-1
Name:Arginase-1
Synonyms:ARG1 | Liver-type arginase | Type I arginase
Type:PROTEIN
Mol. Mass.:34737.53
Organism:Homo sapiens (Human)
Description:ChEMBL_978893
Residue:322
Sequence:
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGLAREGNHKPIDYLNPPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350310
n/a
NameBDBM50350310
Synonyms:CHEMBL1812663
TypeSmall organic molecule
Emp. Form.C7H14BF2NO4
Mol. Mass.224.998
SMILES[NH3+]C(CCCCB(O)O)(C(F)F)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: