Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Sgk1
LigandBDBM50296011
Substrate/Competitorn/a
Meas. Tech.ChEMBL_763189
IC50 13±n/a nM
Citation Bamborough PBrown MJChristopher JAChung CWMellor GW Selectivity of kinase inhibitor fragments. J Med Chem 54:5131-43 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Sgk1
Name:Serine/threonine-protein kinase Sgk1
Synonyms:SGK1 | Serine/threonine-protein kinase Sgk1 | Serine/threonine-protein kinase Sgk1 (SGK) | Serum/glucocorticoid regulated kinase | Serum/glucocorticoid-regulated kinase 1 (SGK1)
Type:Other Protein Type
Mol. Mass.:48954.40
Organism:Homo sapiens (Human)
Description:Recombinant human SGK-1 enzyme produced in a baculovirus system.
Residue:431
Sequence:
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50296011
n/a
NameBDBM50296011
Synonyms:2-cyclopentyl-4-(5-phenyl-1H-pyrrolo[2,3-b]pyridin-3-yl)benzoic acid | CHEMBL558642
TypeSmall organic molecule
Emp. Form.C25H22N2O2
Mol. Mass.382.4544
SMILESOC(=O)c1ccc(cc1C1CCCC1)-c1c[nH]c2ncc(cc12)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: