Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid DP receptor
LigandBDBM50351484
Substrate/Competitorn/a
Meas. Tech.ChEMBL_764676
IC50 7.4±n/a nM
Citation Iwahashi MTakahashi ETanaka MMatsunaga YOkada YMatsumoto RNambu FNakai HToda M Design and synthesis of new prostaglandin D2 receptor antagonists. Bioorg Med Chem 19:5361-71 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid DP receptor
Name:Prostanoid DP receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40018.63
Organism:Mus musculus
Description:ChEMBL_788408
Residue:357
Sequence:
MNESYRCQTSTWVERGSSATMGAVLFGAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF
YVLVCGLTVTDLLGKCLISPMVLAAYAQNQSLKELLPASGNQLCETFAFLMSFFGLASTL
QLLAMAVECWLSLGHPFFYQRHVTLRRGVLVAPVVAAFCLAFCALPFAGFGKFVQYCPGT
WCFIQMIHKERSFSVIGFSVLYSSLMALLVLATVVCNLGAMYNLYDMHRRQRHYPHRCSR
DRAQSGSDYRHGSLHPLEELDHFVLLALMTVLFTMCSLPLIYRAYYGAFKLENKAEGDSE
DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKVFTRPLIYRNWSSHSQQSNVESTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50351484
n/a
NameBDBM50351484
Synonyms:CHEMBL1819623
TypeSmall organic molecule
Emp. Form.C25H22ClFN2O5
Mol. Mass.484.904
SMILESCN1C[C@@H](COc2ccc(C(=O)Nc3cc(CC(O)=O)ccc3F)c(Cl)c2)Oc2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: