| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50352154 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_767116 (CHEMBL1826165) |
|---|
| Ki | 246±n/a nM |
|---|
| Citation |  Banister, SD; Yoo, DT; Chua, SW; Cui, J; Mach, RH; Kassiou, M N-Arylalkyl-2-azaadamantanes as cage-expanded polycarbocyclic sigma (s) receptor ligands. Bioorg Med Chem Lett21:5289-92 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50352154 |
|---|
| n/a |
|---|
| Name | BDBM50352154 |
|---|
| Synonyms: | CHEMBL1824783 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22FNO |
|---|
| Mol. Mass. | 275.3611 |
|---|
| SMILES | OC12CC3CC(CC(C3)N1CCc1ccc(F)cc1)C2 |TLB:8:7:19:2.3.4,8:3:9.7.6:19,4:5:9:2.8.3,THB:4:3:9:6.5.19,10:9:19:2.3.4| |
|---|
| Structure | 
|
|---|
Search and Browse
