Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 13 (CA XIII)
LigandBDBM50352646
Substrate/Competitorn/a
Meas. Tech.ChEMBL_766491
pH7.5±n/a
Ki 463±n/a nM
Commentsextracted
Citation Rami MInnocenti AMontero JLScozzafava AWinum JYSupuran CT Synthesis of rhodamine B-benzenesulfonamide conjugates and their inhibitory activity against humana- and bacterial/fungalß-carbonic anhydrases. Bioorg Med Chem Lett 21:5210-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 13 (CA XIII)
Name:Carbonic anhydrase 13 (CA XIII)
Synonyms:Carbonic anhydrase XIII (CA XIII)
Type:Enzyme
Mol. Mass.:29445.78
Organism:Homo sapiens (Human)
Description:Q8N1Q1
Residue:262
Sequence:
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50352646
n/a
NameBDBM50352646
Synonyms:CHEMBL1822702
TypeSmall organic molecule
Emp. Form.C36H40N4O4S
Mol. Mass.624.792
SMILESCCN(CC)c1ccc2c(Oc3cc(ccc3C22N(CCc3ccc(cc3)S(N)(=O)=O)C(=O)c3ccccc23)N(CC)CC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: