Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/hydrogen exchanger 1
LigandBDBM50353101
Substrate/Competitorn/a
Meas. Tech.ChEMBL_768436
IC50 1.5±n/a nM
Citation Jin LJiang XMDu PXu JGong GQWang QJXu YG Synthesis and Na+/H+ exchanger inhibitory activity of benzoylguanidine derivatives. Eur J Med Chem 46:4107-16 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium/hydrogen exchanger 1
Name:Sodium/hydrogen exchanger 1
Synonyms:NHE-1 | Na(+)/H(+) exchanger 1 | Solute carrier family 9 member 1
Type:PROTEIN
Mol. Mass.:91655.00
Organism:Rattus norvegicus
Description:ChEMBL_862370
Residue:820
Sequence:
MMLRWSGIWGLYPPRIFPSLLVVVALVGLLPVLRSHGLQLNPTASTIRGSEPPRERSIGD
VTTAPSEPLHHPDDRNLTNLYIEHGAKPVRKAFPVLDIDYLHVRTPFEISLWILLACLMK
IGFHVIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYF
LPLRQFTENLGTILIFAVVGTLWNAFFLGGLLYAVCLVGGEQINNIGLLDTLLFGSIISA
VDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFASYEYVGISDIFLGFL
SFFVVSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMAL
IASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHQWNWTFVIS
TLLFCLIARVLGVLVLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPM
CDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIED
ICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGK
IPSAVSTVSMQNIHPKSAASERILPALSKDKEEEIRKILRSNLQKTRQRLRSYNRHTLVA
DPYEEAWNQMLLRRQKARQLEQKITNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPV
ITIDPASPQSPESVDLVNEELKGKVLGLKRGPRTTPEEEEEDEDGVIMIRSKEPSSPGTD
DVFTPGPSDSPGSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50353101
n/a
NameBDBM50353101
Synonyms:CHEMBL1829137
TypeSmall organic molecule
Emp. Form.C30H38N6O6S
Mol. Mass.610.724
SMILESCOc1ccc(CN2CCN(CCCOc3ccc(cc3NC(=O)c3cccs3)C(=O)NC(N)=N)CC2)c(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: