Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsoprenylcysteine carboxyl methyltransferase
LigandBDBM50353182
Substrate/Competitorn/a
Meas. Tech.ChEMBL_768735
IC50 19400±n/a nM
Citation Bergman JAHahne KHrycyna CAGibbs RA Lipid and sulfur substituted prenylcysteine analogs as human Icmt inhibitors. Bioorg Med Chem Lett 21:5616-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Isoprenylcysteine carboxyl methyltransferase
Name:Isoprenylcysteine carboxyl methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:31943.26
Organism:Homo sapiens (Human)
Description:ChEMBL_956034
Residue:284
Sequence:
MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFT
AGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTV
WRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50353182
n/a
NameBDBM50353182
Synonyms:CHEMBL1829501
TypeSmall organic molecule
Emp. Form.C33H40N4O4
Mol. Mass.556.6951
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-c1cn(-[#6]-[#6@H](-[#7]-[#6](=O)-c2ccccc2-[#8]-c2ccccc2)-[#6](-[#8])=O)nn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: