Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 4
LigandBDBM25150
Substrate/Competitorn/a
Meas. Tech.ChEMBL_769060
Ki 15±n/a nM
Citation Wang HYu NChen DLee KCLye PLChang JWDeng WNg MCLu TKhoo MLPoulsen ASangthongpitag KWu XHu CGoh KCWang XFang LGoh KLKhng HHGoh SKYeo PLiu XBonday ZWood JMDymock BWKantharaj ESun ET Discovery of (2E)-3-{2-butyl-1-[2-(diethylamino)ethyl]-1H-benzimidazol-5-yl}-N-hydroxyacrylamide (SB939), an orally active histone deacetylase inhibitor with a superior preclinical profile. J Med Chem 54:4694-720 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 4
Name:Histone deacetylase 4
Synonyms:HD4 | HDAC4 | Histone acetylase 4(HDAC4) | Human HDAC4 | KIAA0288
Type:Enzyme
Mol. Mass.:119049.39
Organism:Homo sapiens (Human)
Description:P56524
Residue:1084
Sequence:
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVE
LVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDP
PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQL
MGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKV
MEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEE
EPPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25150
n/a
NameBDBM25150
Synonyms:(2E)-N-hydroxy-3-[3-(phenylsulfamoyl)phenyl]prop-2-enamide | Belinosta | Belinostat | PXD-101 | PXD101
TypeSmall organic molecule
Emp. Form.C15H14N2O4S
Mol. Mass.318.348
SMILESONC(=O)\C=C\c1cccc(c1)S(=O)(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: