Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 11
LigandBDBM50353230
Substrate/Competitorn/a
Meas. Tech.ChEMBL_769067
Ki 13±n/a nM
Citation Wang HYu NChen DLee KCLye PLChang JWDeng WNg MCLu TKhoo MLPoulsen ASangthongpitag KWu XHu CGoh KCWang XFang LGoh KLKhng HHGoh SKYeo PLiu XBonday ZWood JMDymock BWKantharaj ESun ET Discovery of (2E)-3-{2-butyl-1-[2-(diethylamino)ethyl]-1H-benzimidazol-5-yl}-N-hydroxyacrylamide (SB939), an orally active histone deacetylase inhibitor with a superior preclinical profile. J Med Chem 54:4694-720 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 11
Name:Histone deacetylase 11
Synonyms:HD11 | Human HDAC11
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:39187.66
Organism:Homo sapiens (Human)
Description:Recombinant HDAC11 was expressed in Sf9 cells.
Residue:347
Sequence:
MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSML
VEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVER
NIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT
SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50353230
n/a
NameBDBM50353230
Synonyms:CHEMBL1830420
TypeSmall organic molecule
Emp. Form.C20H30N4O2
Mol. Mass.358.4778
SMILESCCCCCCc1nc2cc(\C=C\C(=O)NO)ccc2n1CCNCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: