Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-amino-acid oxidase
LigandBDBM31156
Substrate/Competitorn/a
Meas. Tech.ChEMBL_769923
Kd 2.5±n/a nM
Citation Lange JHVenhorst Jvan Dongen MJFrankena JBassissi Fde Bruin NMden Besten Cde Beer SBOostenbrink CMarkova NKruse CG Biophysical and physicochemical methods differentiate highly ligand-efficient human D-amino acid oxidase inhibitors. Eur J Med Chem 46:4808-19 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D-amino-acid oxidase
Name:D-amino-acid oxidase
Synonyms:D-amino-acid oxidase (DAAO) | DAAO | DAMOX | DAO
Type:Homodimer
Mol. Mass.:39476.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:347
Sequence:
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31156
n/a
NameBDBM31156
Synonyms:3-hydroxyquinolin-2(1H)-one, 10
TypeSmall organic molecule
Emp. Form.C9H6ClNO2
Mol. Mass.195.602
SMILESOc1cc2c(Cl)cccc2[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: