Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-aspartate oxidase
LigandBDBM31147
Substrate/Competitorn/a
Meas. Tech.ChEMBL_769926
IC50>10000±n/a nM
Citation Lange JHVenhorst Jvan Dongen MJFrankena JBassissi Fde Bruin NMden Besten Cde Beer SBOostenbrink CMarkova NKruse CG Biophysical and physicochemical methods differentiate highly ligand-efficient human D-amino acid oxidase inhibitors. Eur J Med Chem 46:4808-19 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D-aspartate oxidase
Name:D-aspartate oxidase
Synonyms:DASOX | DDO
Type:PROTEIN
Mol. Mass.:37669.70
Organism:Bos taurus
Description:ChEMBL_769926
Residue:341
Sequence:
MDTVRIAVVGAGVMGLSTAVCISKMVPGCSITVISDKFTPETTSDVAAGMLIPPTYPDTP
IQKQKQWFKETFDHLFAIVNSAEAEDAGVILVSGWQIFQSIPTEEVPYWADVVLGFRKMT
KDELKKFPQHVFGHAFTTLKCEGPAYLPWLQKRVKGNGGLILTRRIEDLWELHPSFDIVV
NCSGLGSRQLAGDSKIFPVRGQVLKVQAPWVKHFIRDSSGLTYIYPGVSNVTLGGTRQKG
DWNLSPDAEISKEILSRCCALEPSLRGAYDLREKVGLRPTRPSVRLEKELLAQDSRRLPV
VHHYGHGSGGIAMHWGTALEATRLVNECVQVLRTPAPKSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31147
n/a
NameBDBM31147
Synonyms:4H-furo[3,2-b]pyrrole-5-carboxylic acid | 5-carboxyfuro[3,2-b]pyrrole, 1 | CHEMBL492591
TypeSmall organic molecule
Emp. Form.C7H5NO3
Mol. Mass.151.1195
SMILESOC(=O)c1cc2occc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: