Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-7
LigandBDBM10759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_770045
Ki 7943.28±n/a nM
Citation Akdemir ARucktooa PJongejan AElk RBertrand SSixma TKBertrand DSmit ABLeurs Rde Graaf Cde Esch IJ Acetylcholine binding protein (AChBP) as template for hierarchical in silico screening procedures to identify structurally novel ligands for the nicotinic receptors. Bioorg Med Chem 19:6107-19 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor subunit alpha-7
Name:Neuronal acetylcholine receptor subunit alpha-7
Synonyms:CHRNA7 | Cholinergic, Nicotinic Alpha7 | NACHRA7 | Neuronal acetylcholine receptor protein alpha-7 subunit | Neuronal acetylcholine receptor subunit alpha-7 (nAChR-alpha 7) | Nicotinic acetylcholine receptor alpha-7 (alpha7 nAChR)
Type:n/a
Mol. Mass.:56448.33
Organism:Homo sapiens (Human)
Description: CHRNA7 (NACHRA7)
Residue:502
Sequence:
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10759
n/a
NameBDBM10759
Synonyms:2-acetoxyethyl(trimethyl)ammonium;bromide | 2-acetoxyethyl(trimethyl)ammonium;perchlorate | CHEMBL667 | [2-(acetyloxy)ethyl]trimethylazanium | acetylcholine | acetylcholine chloride | cid_6060
TypeSmall Organic Molecule
Emp. Form.C7H16NO2
Mol. Mass.146.2069
SMILESCC(=O)OCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: