Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 3 |
---|
Ligand | BDBM50354138 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_770834 (CHEMBL1837782) |
---|
EC50 | >31622.78±n/a nM |
---|
Citation | Demont, EH; Arpino, S; Bit, RA; Campbell, CA; Deeks, N; Desai, S; Dowell, SJ; Gaskin, P; Gray, JR; Harrison, LA; Haynes, A; Heightman, TD; Holmes, DS; Humphreys, PG; Kumar, U; Morse, MA; Osborne, GJ; Panchal, T; Philpott, KL; Taylor, S; Watson, R; Willis, R; Witherington, J Discovery of a brain-penetrant S1P3-sparing direct agonist of the S1P¿? and S1P5 receptors efficacious at low oral dose. J Med Chem54:6724-33 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 3 |
---|
Name: | Sphingosine 1-phosphate receptor 3 |
Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42278.13 |
Organism: | Homo sapiens (Human) |
Description: | Q99500 |
Residue: | 378 |
Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
BDBM50354138 |
---|
n/a |
---|
Name | BDBM50354138 |
Synonyms: | CHEMBL1836215 |
Type | Small organic molecule |
Emp. Form. | C25H28N4O4 |
Mol. Mass. | 448.5142 |
SMILES | CC(C)Oc1ccc(cc1C#N)-c1nc(no1)-c1ccc2CN(CCc2c1C)C(CO)CO |
Structure |
|