| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 2 |
|---|
| Ligand | BDBM23165 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_770833 (CHEMBL1837638) |
|---|
| EC50 | >31622.78±n/a nM |
|---|
| Citation |  Demont, EH; Arpino, S; Bit, RA; Campbell, CA; Deeks, N; Desai, S; Dowell, SJ; Gaskin, P; Gray, JR; Harrison, LA; Haynes, A; Heightman, TD; Holmes, DS; Humphreys, PG; Kumar, U; Morse, MA; Osborne, GJ; Panchal, T; Philpott, KL; Taylor, S; Watson, R; Willis, R; Witherington, J Discovery of a brain-penetrant S1P3-sparing direct agonist of the S1P¿? and S1P5 receptors efficacious at low oral dose. J Med Chem54:6724-33 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 2 |
|---|
| Name: | Sphingosine 1-phosphate receptor 2 |
|---|
| Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38883.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
|---|
| Residue: | 353 |
|---|
| Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
|---|
| BDBM23165 |
|---|
| n/a |
|---|
| Name | BDBM23165 |
|---|
| Synonyms: | CHEMBL366208 | FTY720-phosphate, (S)-2 | [(2S)-2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy]phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H34NO5P |
|---|
| Mol. Mass. | 387.4507 |
|---|
| SMILES | CCCCCCCCc1ccc(CC[C@](N)(CO)COP(O)(O)=O)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
