Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRC
LigandBDBM50354480
Substrate/Competitorn/a
Meas. Tech.ChEMBL_771567
Ki 3870±n/a nM
Citation Radi MBrullo CCrespan ETintori CMusumeci FBiava MSchenone SDreassi EZamperini CMaga GPagano DAngelucci ABologna MBotta M Identification of potent c-Src inhibitors strongly affecting the proliferation of human neuroblastoma cells. Bioorg Med Chem Lett 21:5928-33 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SRC
Name:SRC
Synonyms:HCK | Tyrosine-protein kinase Blk | Tyrosine-protein kinase HCK | Tyrosine-protein kinase HCK
Type:Enzyme Catalytic Domain
Mol. Mass.:59600.18
Organism:Homo sapiens (Human)
Description:gi_30795229
Residue:526
Sequence:
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50354480
n/a
NameBDBM50354480
Synonyms:CHEMBL1836678
TypeSmall organic molecule
Emp. Form.C21H21N5S
Mol. Mass.375.49
SMILESCSc1nc(Nc2ccccc2)c2cnn(CC(C)c3ccccc3)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: