Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase HCK
LigandBDBM50354481
Substrate/Competitorn/a
Meas. Tech.ChEMBL_771567
Ki 5000±n/a nM
Citation Radi MBrullo CCrespan ETintori CMusumeci FBiava MSchenone SDreassi EZamperini CMaga GPagano DAngelucci ABologna MBotta M Identification of potent c-Src inhibitors strongly affecting the proliferation of human neuroblastoma cells. Bioorg Med Chem Lett 21:5928-33 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase HCK
Name:Tyrosine-protein kinase HCK
Synonyms:HCK | Hematopoietic cell kinase | Hemopoietic cell kinase | p59-HCK/p60-HCK | p59Hck | p61Hck
Type:Enzyme Catalytic Domain
Mol. Mass.:59600.18
Organism:Homo sapiens (Human)
Description:P08631
Residue:526
Sequence:
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50354481
n/a
NameBDBM50354481
Synonyms:CHEMBL1836679
TypeSmall organic molecule
Emp. Form.C21H20ClN5S
Mol. Mass.409.935
SMILESCSc1nc(Nc2cccc(Cl)c2)c2cnn(CC(C)c3ccccc3)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: