| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM50354480 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_771568 (CHEMBL1837747) |
|---|
| Ki | 11500±n/a nM |
|---|
| Citation |  Radi, M; Brullo, C; Crespan, E; Tintori, C; Musumeci, F; Biava, M; Schenone, S; Dreassi, E; Zamperini, C; Maga, G; Pagano, D; Angelucci, A; Bologna, M; Botta, M Identification of potent c-Src inhibitors strongly affecting the proliferation of human neuroblastoma cells. Bioorg Med Chem Lett21:5928-33 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM50354480 |
|---|
| n/a |
|---|
| Name | BDBM50354480 |
|---|
| Synonyms: | CHEMBL1836678 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21N5S |
|---|
| Mol. Mass. | 375.49 |
|---|
| SMILES | CSc1nc(Nc2ccccc2)c2cnn(CC(C)c3ccccc3)c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
