Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-2 |
---|
Ligand | BDBM50355393 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_773548 (CHEMBL1839914) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Guagnano, V; Furet, P; Spanka, C; Bordas, V; Le Douget, M; Stamm, C; Brueggen, J; Jensen, MR; Schnell, C; Schmid, H; Wartmann, M; Berghausen, J; Drueckes, P; Zimmerlin, A; Bussiere, D; Murray, J; Graus Porta, D Discovery of 3-(2,6-dichloro-3,5-dimethoxy-phenyl)-1-{6-[4-(4-ethyl-piperazin-1-yl)-phenylamino]-pyrimidin-4-yl}-1-methyl-urea (NVP-BGJ398), a potent and selective inhibitor of the fibroblast growth factor receptor family of receptor tyrosine kinase. J Med Chem54:7066-83 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-2 |
---|
Name: | Serine/threonine-protein kinase pim-2 |
Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
Type: | Serine/threonine-protein kinase |
Mol. Mass.: | 34185.93 |
Organism: | Homo sapiens (Human) |
Description: | Q9P1W9 |
Residue: | 311 |
Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
BDBM50355393 |
---|
n/a |
---|
Name | BDBM50355393 |
Synonyms: | BGJ398 | CHEMBL1834657 | US9434697, BGJ398 | US9730931, BGJ398 |
Type | Small organic molecule |
Emp. Form. | C26H31Cl2N7O3 |
Mol. Mass. | 560.475 |
SMILES | CCN1CCN(CC1)c1ccc(Nc2cc(ncn2)N(C)C(=O)Nc2c(Cl)c(OC)cc(OC)c2Cl)cc1 |
Structure |
|