Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUridine-5'-diphosphoglucuronosyltransferase 1A6
LigandBDBM50085045
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774126
Ki 20000±n/a nM
Citation Kiang TKEnsom MHChang TK UDP-glucuronosyltransferases and clinical drug-drug interactions. Pharmacol Ther 106:97-132 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Uridine-5'-diphosphoglucuronosyltransferase 1A6
Name:Uridine-5'-diphosphoglucuronosyltransferase 1A6
Synonyms:Phenol-metabolizing UDP-glucuronosyltransferase | UDP-glucuronosyltransferase 1-6 | UDP-glucuronosyltransferase 1-F | UDP-glucuronosyltransferase 1A6 | UDPGT 1-6 | UGT-1F | UGT1*6 | UGT1-06 | UGT1.6 | UGT1F
Type:Enzyme
Mol. Mass.:60765.14
Organism:Homo sapiens (Human)
Description:P19224
Residue:532
Sequence:
MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVV
PEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIG
LYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEH
TFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRD
VDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLL
GHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE
DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDL
TWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085045
n/a
NameBDBM50085045
Synonyms:5-((4-((6-hydroxy-2,5,7,8-tetramethyl-3,4-dihydro-2H-chromen-2-yl)methoxy)phenyl)methyl)thiazolidine-2,4-dione | 5-(4-((6-hydroxy-2,5,7,8-tetramethylchroman-2-yl)methoxy)benzyl)thiazolidine-2,4-dione | 5-[4-(6-Hydroxy-2,5,7,8-tetramethyl-chroman-2-ylmethoxy)-benzy l]-thiazolidine-2,4-dione (troglitazone) | 5-[4-(6-Hydroxy-2,5,7,8-tetramethyl-chroman-2-ylmethoxy)-benzyl]-thiazolidine-2,4-dione | 5-[4-(6-Hydroxy-2,5,7,8-tetramethyl-chroman-2-ylmethoxy)-benzyl]-thiazolidine-2,4-dione(troglitazone) | 5-[4-(6-Hydroxy-2,5,7,8-tetramethyl-chroman-2-ylmethoxy)-benzyl]-thiazolidine-2,4-dioneTroglitazone | CHEMBL408 | CI-991 | CS-045 | GR92132X | PRELAY | REZULIN | TROGLITAZONE
TypeSmall organic molecule
Emp. Form.C24H27NO5S
Mol. Mass.441.54
SMILESCc1c(C)c2OC(C)(COc3ccc(Cc4sc(=O)[nH]c4O)cc3)CCc2c(C)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: