Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscle, skeletal receptor tyrosine protein kinase
LigandBDBM50026612
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774502
Kd 590±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscle, skeletal receptor tyrosine protein kinase
Name:Muscle, skeletal receptor tyrosine protein kinase
Synonyms:MUSK
Type:PROTEIN
Mol. Mass.:97062.85
Organism:Homo sapiens (Human)
Description:ChEMBL_1474077
Residue:869
Sequence:
MRELVNIPLVHILTLVAFSGTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEIS
WTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMK
PKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLESGSLRIHNV
QKEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAPESHNVTFGSFVTLHCTATGIPV
PTITWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT
ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELK
VVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLAVKELFCAKEWLVMEEKTHRG
LYRSEMHLLSVPECSKLPSMHWDPTACARLPHLDYNKENLKTFPPMTSSKPSVDIPNLPS
SSSSSFSVSPTYSMTVIISIMSSFAIFVLLTITTLYCCRRRKQWKNKKRESAAVTLTTLP
SELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPY
EPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAY
GDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERK
FVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYT
TESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWS
KLPADRPSFTSIHRILERMCERAEGTVSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026612
n/a
NameBDBM50026612
Synonyms:BIBF-1120 | NINTEDANIB | Nintedanib | Vargatef
TypeSmall organic molecule
Emp. Form.C31H33N5O4
Mol. Mass.539.6248
SMILESCOC(=O)c1ccc2\C(=C(\Nc3ccc(cc3)N(C)C(=O)CN3CCN(C)CC3)c3ccccc3)C(=O)Nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: