Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase SRPK3
LigandBDBM31095
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774558
Kd 120±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase SRPK3
Name:Serine/threonine-protein kinase SRPK3
Synonyms:MSSK-1 | Muscle-specific serine kinase 1 | SR-protein-specific kinase 3 | SRSF protein kinase 3 | Serine/arginine-rich protein-specific kinase 3 | Serine/threonine-protein kinase 23
Type:PROTEIN
Mol. Mass.:62021.04
Organism:Homo sapiens (Human)
Description:ChEMBL_655942
Residue:567
Sequence:
MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKD
YCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETA
VDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNY
QGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQA
GAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKRLLEERLRDLQRLEAMEAATQ
AEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQTSGFSGSLFSP
ASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF
TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAH
IVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSA
FLLPMMEYIPEKRASAADCLQHPWLNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31095
n/a
NameBDBM31095
Synonyms:5-[(Z)-(5-fluoranyl-2-oxidanylidene-1H-indol-3-ylidene)methyl]-2,4-dimethyl-N-[(2S)-3-morpholin-4-yl-2-oxidanyl-propyl]-1H-pyrrole-3-carboxamide | 5-[(Z)-(5-fluoro-2-keto-indolin-3-ylidene)methyl]-N-[(2S)-2-hydroxy-3-morpholino-propyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | 5-[(Z)-(5-fluoro-2-oxo-1H-indol-3-ylidene)methyl]-N-[(2S)-2-hydroxy-3-(4-morpholinyl)propyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | 5-[(Z)-(5-fluoro-2-oxo-1H-indol-3-ylidene)methyl]-N-[(2S)-2-hydroxy-3-morpholin-4-ylpropyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | SU-14813 | cid_10138259
TypeSmall organic molecule
Emp. Form.C23H27FN4O4
Mol. Mass.442.4833
SMILESCc1[nH]c(\C=C2/C(=O)Nc3ccc(F)cc23)c(C)c1C(=O)NC[C@H](O)CN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: