Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase RIO3
LigandBDBM5446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774406
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase RIO3
Name:Serine/threonine-protein kinase RIO3
Synonyms:RIOK3
Type:PROTEIN
Mol. Mass.:59082.79
Organism:Homo sapiens (Human)
Description:ChEMBL_774406
Residue:519
Sequence:
MDLVGVASPEPGTAAAWGPSKCPWAIPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVA
VAEGPFITGENIDTSSDLMLAQMLQMEYDREYDAQLRREEKKFNGDSKVSISFENYRKVH
PYEDSDSSEDEVDWQDTRDDPYRPAKPVPTPKKGFIGKGKDITTKHDEVVCGRKNTARME
NFAPEFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKEHSTAEKAVDPKTRLL
MYKMVNSGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFK
NRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMS
FIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVW
LIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEAD
FLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5446
n/a
NameBDBM5446
Synonyms:CHEMBL553 | ERLOTINIB HYDROCHLORIDE | Erlotinib | Erotinib | N-(3-Ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine Monohydrochloride | N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)quinazolin-4-amine | OSI-774 | Tarceva | US10189853, erlotinib | US9409845, Table 1, Compound 22: erlotinib | US9730934, Erlotinib | cid_176870
TypeSmall organic molecule
Emp. Form.C22H23N3O4
Mol. Mass.393.4357
SMILESCOCCOc1cc2ncnc(Nc3cccc(c3)C#C)c2cc1OCCOC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: