Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase MST2
LigandBDBM50309910
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774534
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase MST2
Name:Serine/threonine-protein kinase MST2
Synonyms:MST-2 | Mammalian STE20-like protein kinase 2 | STE20-Like Kinase MST2 | STK3 | Serine/threonine-protein kinase 3 | Serine/threonine-protein kinase 3 (MST2) | Serine/threonine-protein kinase Krs-1
Type:Serine/threonine-protein kinase
Mol. Mass.:56284.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50309910
n/a
NameBDBM50309910
Synonyms:CHEMBL608154 | ML-120B | N-(6-chloro-7-methoxy-9H-pyrido[3,4-b]indol-8-yl)-2-methylnicotinamide
TypeSmall organic molecule
Emp. Form.C19H15ClN4O2
Mol. Mass.366.801
SMILESCOc1c(Cl)cc2c3ccncc3[nH]c2c1NC(=O)c1cccnc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: