Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform delta
LigandBDBM5447
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774196
Kd 3200±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform delta
Name:Casein kinase I delta/epsilon
Synonyms:CKI-delta | CKId | CSNK1D | Casein kinase 1 delta (CK1δ) | Casein kinase I delta | Casein kinase I isoform delta (CK1D) | casein kinases 1 delta (CK1 delta)
Type:Enzyme
Mol. Mass.:47356.76
Organism:Homo sapiens (Human)
Description:P48730
Residue:415
Sequence:
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5447
n/a
NameBDBM5447
Synonyms:CHEMBL939 | GEFITINIB | Iressa | N-(3-Chloro-4-fluorophenyl)-7-methoxy-6-[3-(4-morpholinyl)propoxy]-4-quinazolinamine | N-(3-chloro-4-fluorophenyl)-7-methoxy-6-[3-(morpholin-4-yl)propoxy]quinazolin-4-amine | US10106508, Gefitinib | US9416123, Gefitinib | US9730934, Gefitinib | US9783524, Gefitinib | ZD1839 | cid_123631
TypeSmall organic molecule
Emp. Form.C22H24ClFN4O3
Mol. Mass.446.902
SMILESCOc1cc2ncnc(Nc3ccc(F)c(Cl)c3)c2cc1OCCCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: