Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetp21-Activated kinase 3 (PAK3)
LigandBDBM50300690
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774353
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
p21-Activated kinase 3 (PAK3)
Name:p21-Activated kinase 3 (PAK3)
Synonyms:PAK3 | Serine/threonine-protein kinase PAK 3
Type:Enzyme
Mol. Mass.:62298.33
Organism:Homo sapiens (Human)
Description:O75914
Residue:559
Sequence:
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300690
n/a
NameBDBM50300690
Synonyms:CHEMBL576982 | N-(5-tert-Butyl-isoxazol-3-yl)-N'-{4-[7-(2-morpholin-4-yl-ethoxy)imidazo[2,1-b][1,3]benzothiazol-2-yl]phenyl}urea | US9216997, Quizartinib (positive compound)
TypeSmall organic molecule
Emp. Form.C29H32N6O4S
Mol. Mass.560.667
SMILESCC(C)(C)c1cc(NC(=O)Nc2ccc(cc2)-c2cn3c(n2)sc2cc(OCCN4CCOCC4)ccc32)no1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: