Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 15
LigandBDBM4779
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774198
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 15
Name:Cyclin-dependent kinase 15
Synonyms:ALS2CR7 | Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein | CDK15 | Cell division protein kinase 15 | PFTK2 | Serine/threonine-protein kinase ALS2CR7 | Serine/threonine-protein kinase PFTAIRE-2
Type:PROTEIN
Mol. Mass.:49029.02
Organism:Homo sapiens (Human)
Description:ChEMBL_655517
Residue:435
Sequence:
MGQELCAKTVQPGCSCYHCSEGGEAHSCRRSQPETTEAAFKLTDLKEASCSMTSFHPRGL
QAARAQKFKSKRPRSNSDCFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEY
MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKL
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEA
EDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLA
SYQKGHHPAQFSKCW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4779
n/a
NameBDBM4779
Synonyms:CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib | N-{4-[(3-chloro-4-fluorophenyl)amino]-7-[3-(morpholin-4-yl)propoxy]quinazolin-6-yl}prop-2-enamide | PD0183805 | US9730934, CI-1033 | cid_156414
TypeSmall organic molecule
Emp. Form.C24H25ClFN5O3
Mol. Mass.485.938
SMILESFc1ccc(Nc2ncnc3cc(OCCCN4CCOCC4)c(NC(=O)C=C)cc23)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: