Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase I delta
LigandBDBM36409
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774598
Kd 1500±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase I delta
Name:CaM kinase I delta
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42916.83
Organism:Homo sapiens (Human)
Description:ChEMBL_586559
Residue:385
Sequence:
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTAVHSGSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36409
n/a
NameBDBM36409
Synonyms:2-(4-amino-1-isopropyl-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol, PP242 | CID24905147 | US10172858, Table 2.1
TypeSmall organic molecule
Emp. Form.C16H16N6O
Mol. Mass.308.3378
SMILESCC(C)n1nc(-c2cc3cc(O)ccc3[nH]2)c2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: