Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenin
LigandBDBM50355519
Substrate/Competitorn/a
Meas. Tech.ChEMBL_776436
IC50 3.4±n/a nM
Citation Chen ACauchon EChefson ADolman SDucharme YDubé DFalgueyret JPFournier PAGagné SGallant MGrimm EHan YHoule RHuang JQHughes GJûteau HLacombe PLauzon SLévesque JFLiu SMacdonald DMackay BMcKay DPercival MDSt-Jacques RToulmond S Renin inhibitors for the treatment of hypertension: design and optimization of a novel series of tertiary alcohol-bearing piperidines. Bioorg Med Chem Lett 21:3976-81 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Renin
Name:Renin
Synonyms:Angiotensinogenase
Type:Enzyme
Mol. Mass.:45058.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:406
Sequence:
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50355519
n/a
NameBDBM50355519
Synonyms:CHEMBL1910321
TypeSmall organic molecule
Emp. Form.C30H29F3N4O2
Mol. Mass.534.5721
SMILESO[C@@]1(CCNC[C@@H]1C(=O)N(Cc1cn(Cc2cccnc2)c2cccc(F)c12)C1CC1)c1ccc(F)c(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: