| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50355781 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_776493 (CHEMBL1913590) |
|---|
| IC50 | 0.14±n/a nM |
|---|
| Citation |  Cappelli, A; Bini, G; Valenti, S; Giuliani, G; Paolino, M; Anzini, M; Vomero, S; Giorgi, G; Giordani, A; Stasi, LP; Makovec, F; Ghelardini, C; Di Cesare Mannelli, L; Concas, A; Porcu, P; Biggio, G Synthesis and structure-activity relationship studies in translocator protein ligands based on a pyrazolo[3,4-b]quinoline scaffold. J Med Chem54:7165-75 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50355781 |
|---|
| n/a |
|---|
| Name | BDBM50355781 |
|---|
| Synonyms: | CHEMBL1911620 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H26N4O2 |
|---|
| Mol. Mass. | 402.4888 |
|---|
| SMILES | CCCCN(C)C(=O)Cn1c2nn(-c3ccccc3)c(=O)c2c(C)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
