Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProgesterone receptor
LigandBDBM8903
Substrate/Competitorn/a
Meas. Tech.ChEMBL_775980
IC50 6±n/a nM
Citation Nagata NMiyakawa MAmano SFuruya KYamamoto NNejishima HInoguchi K Tetrahydroquinolines as a novel series of nonsteroidal selective androgen receptor modulators: structural requirements for better physicochemical and biological properties. Bioorg Med Chem Lett 21:6310-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Progesterone receptor
Name:Progesterone receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:98665.51
Organism:Oryctolagus cuniculus
Description:ChEMBL_775980
Residue:930
Sequence:
MTELKAKEPRAPHVAGGAPSPTEVGSQLLGRPDPGPFQGSQTSEASSVVSAIPISLDGLL
FPRPCQGQNPPDGKTQDPPSLSDVEGAFPGVEAPEGAGDSSSRPPEKDSGLLDSVLDTLL
APSGPGQSHASPATCEAISPWCLFGPDLPEDPRAAPATKGVLAPLMSRPEDKAGDSSGTA
AAHKVLPRGLSPSRQLLLPSSGSPHWPAVKPSPQPAAVQVDEEDSSESEGTVGPLLKGQP
RALGGTAAGGGAAPVASGAAAGGVALVPKEDSRFSAPRVSLAEQDAPVAPGRSPLATSVV
DFIHVPILPLNHAFLATRTRQLLEGESYDGGAAAASPFVPQRGSPSASSTPVAGGDFPDC
TYPPDAEPKDDAFPLYGDFQPPALKIKEEEEAAEAAARSPRTYLVAGANPAAFPDFQLAA
PPPPSLPPRVPSSRPGEAAVAASPGSASVSSSSSSGSTLECILYKAEGAPPQQGPFAPLP
CKPPGAGACLLPRDGLPSTSASGAAAGAAPALYPTLGLNGLPQLGYQAAVLKEGLPQVYT
PYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQH
NYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAVALPQP
VGIPNESQRITFSPSQEIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGE
RQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLI
LNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQSQFEE
MRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSV
EFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8903
n/a
NameBDBM8903
Synonyms:(1S,2R,10S,11S,14S,15S)-14-acetyl-2,15-dimethyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadec-6-en-5-one | CHEMBL103 | progesterone
TypeSteroid
Emp. Form.C21H30O2
Mol. Mass.314.4617
SMILES[H][C@@]12CC[C@H](C(C)=O)[C@@]1(C)CC[C@@]1([H])[C@@]2([H])CCC2=CC(=O)CC[C@]12C |r,t:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: