Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucocorticoid
LigandBDBM50355936
Substrate/Competitorn/a
Meas. Tech.ChEMBL_775982
IC50 49000±n/a nM
Citation Nagata NMiyakawa MAmano SFuruya KYamamoto NNejishima HInoguchi K Tetrahydroquinolines as a novel series of nonsteroidal selective androgen receptor modulators: structural requirements for better physicochemical and biological properties. Bioorg Med Chem Lett 21:6310-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glucocorticoid
Name:Glucocorticoid receptor
Synonyms:Glucocorticoid Receptor (GR) | Glucocorticoid receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:87556.83
Organism:RAT
Description:Glucocorticoid 0 RAT::P06536
Residue:795
Sequence:
MDSKESLAPPGRDEVPGSLLGQGRGSVMDFYKSLRGGATVKVSASSPSVAAASQADSKQQ
RILLDFSKGSTSNVQQRQQQQQQQQQQQQQQQQQQQPDLSKAVSLSMGLYMGETETKVMG
NDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSVPENPKSSTSATGCATPTEKEFPKT
HSDASSEQQNRKSQTGTNGGSVKLYPTDQSTFDLLKDLEFSAGSPSKDTNESPWRSDLLI
DENLLSPLAGEDDPFLLEGNTNEDCKPLILPDTKPKIKDTGDTILSSPSSVALPQVKTEK
DDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTAS
LSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDSLTSLGALNFPGRSVFSNGYSSPGMRP
DVSSPPSSSSAATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRN
DCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENPNKTIVP
AALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIL
GLRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSGNLLCFAPDLIINEQRMSLPCMYDQ
CKHMLFVSSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIV
KREGNSSQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIP
KYSNGNIKKLLFHQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50355936
n/a
NameBDBM50355936
Synonyms:CHEMBL1910411
TypeSmall organic molecule
Emp. Form.C15H23N3O3
Mol. Mass.293.3614
SMILESCN(C)[C@H]1C[C@H](Nc2ccc(cc12)[N+]([O-])=O)C(C)(C)CO |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: