Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMineralocorticoid receptor
LigandBDBM50356050
Substrate/Competitorn/a
Meas. Tech.ChEMBL_775648
IC50 45±n/a nM
Citation Betageri RGilmore TKuzmich DKirrane TMBentzien JWiedenmayer DBekkali YRegan JBerry ALatli BKukulka AJFadra TNNelson RMGoldrick SZuvela-Jelaska LSouza DPelletier JDinallo RPanzenbeck MTorcellini CLee HPack EHarcken CNabozny GThomson DS Non-steroidal dissociated glucocorticoid agonists: indoles as A-ring mimetics and function-regulating pharmacophores. Bioorg Med Chem Lett 21:6842-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mineralocorticoid receptor
Name:Mineralocorticoid receptor
Synonyms:MCR | MLR | MR | NR3C2 | Nuclear receptor subfamily 3 group C member 2
Type:Enzyme
Mol. Mass.:107076.42
Organism:Homo sapiens (Human)
Description:P08235
Residue:984
Sequence:
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAV
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN
TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV
VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML
VEIISDQLPKVESGNAKPLYFHRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50356050
n/a
NameBDBM50356050
Synonyms:CHEMBL1911650
TypeSmall organic molecule
Emp. Form.C23H22F4N2O2
Mol. Mass.434.4266
SMILESCOc1ccc(F)cc1C(C)(C)C[C@@](O)(Cc1cc2cc(ccc2[nH]1)C#N)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: