Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50356669 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_785712 (CHEMBL1920640) |
---|
Ki | 2.4±n/a nM |
---|
Citation | Crosignani, S; Prêtre, A; Jorand-Lebrun, C; Fraboulet, G; Seenisamy, J; Augustine, JK; Missotten, M; Humbert, Y; Cleva, C; Abla, N; Daff, H; Schott, O; Schneider, M; Burgat-Charvillon, F; Rivron, D; Hamernig, I; Arrighi, JF; Gaudet, M; Zimmerli, SC; Juillard, P; Johnson, Z Discovery of potent, selective, and orally bioavailable alkynylphenoxyacetic acid CRTH2 (DP2) receptor antagonists for the treatment of allergic inflammatory diseases. J Med Chem54:7299-317 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD294 antigen | Crth2 | G protein-coupled receptor 44 | Gpr44 | PD2R2_MOUSE | Ptgdr2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42975.89 |
Organism: | Mus musculus (mouse) |
Description: | Human embryonic kidney (HEK) 293(EBNA) cells were transfected with mouse CRTH2. |
Residue: | 382 |
Sequence: | MANVTLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM
RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL
LSAISLDRCLQVVRPVWAQNHRTVAVAHRVCLMLWALAVLNTIPYFVFRDTIPRLDGRIM
CYYNLLLWNPGPDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLRLHHRGRQRT
GRFVRLVAAIVVAFVLCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP
LLYVFTCPDMLYKLRRSLRAVLESVLVEDSDQSGGLRNRRRRASSTATPASTLLLADRIP
QLRPTRLIGWMRRGSAEVPQRV
|
|
|
BDBM50356669 |
---|
n/a |
---|
Name | BDBM50356669 |
Synonyms: | CHEMBL1917584 |
Type | Small organic molecule |
Emp. Form. | C20H19ClO5S |
Mol. Mass. | 406.88 |
SMILES | CCCS(=O)(=O)c1ccc(C)c(c1)C#Cc1cc(Cl)ccc1OCC(O)=O |
Structure |
|