Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM50357276 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_788365 (CHEMBL1918046) |
---|
Ki | 601±n/a nM |
---|
Citation | Masood, MA; Selby, MD; Bell, AS; Mansfield, AC; Gardner, M; Smith, GF; Lane, C; Kenyon-Edwards, H; Osborne, R; Jones, RM; Liu, WL; Brown, CD; Clarke, N; Perrucio, F; Mowbray, CE Discovery of a series of potent and selective human H4 antagonists using ligand efficiency and libraries to explore structure-activity relationship (SAR). Bioorg Med Chem Lett21:6591-5 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM50357276 |
---|
n/a |
---|
Name | BDBM50357276 |
Synonyms: | CHEMBL1916502 |
Type | Small organic molecule |
Emp. Form. | C20H35N5 |
Mol. Mass. | 345.5254 |
SMILES | CC(C)(C)CCNc1cc(ncn1)N1CCN(CC1)C1CCCCC1 |
Structure |
|