| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H4 receptor |
|---|
| Ligand | BDBM50060682 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_788365 (CHEMBL1918046) |
|---|
| Ki | 1060±n/a nM |
|---|
| Citation |  Masood, MA; Selby, MD; Bell, AS; Mansfield, AC; Gardner, M; Smith, GF; Lane, C; Kenyon-Edwards, H; Osborne, R; Jones, RM; Liu, WL; Brown, CD; Clarke, N; Perrucio, F; Mowbray, CE Discovery of a series of potent and selective human H4 antagonists using ligand efficiency and libraries to explore structure-activity relationship (SAR). Bioorg Med Chem Lett21:6591-5 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H4 receptor |
|---|
| Name: | Histamine H4 receptor |
|---|
| Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44517.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
|---|
| Residue: | 390 |
|---|
| Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
|---|
| BDBM50060682 |
|---|
| n/a |
|---|
| Name | BDBM50060682 |
|---|
| Synonyms: | 2-(4-Methyl-piperazin-1-yl)-quinoxaline | CHEMBL123137 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H16N4 |
|---|
| Mol. Mass. | 228.2929 |
|---|
| SMILES | CN1CCN(CC1)c1cnc2ccccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
