Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Lyn
LigandBDBM50357312
Substrate/Competitorn/a
Meas. Tech.ChEMBL_788549
IC50 200±n/a nM
Citation Kim KHMaderna ASchnute MEHegen MMohan SMiyashiro JLin LLi EKeegan SLussier JWrocklage CNickerson-Nutter CLWittwer AJSoutter HCaspers NHan SKurumbail RDunussi-Joannopoulos KDouhan JWissner A Imidazo[1,5-a]quinoxalines as irreversible BTK inhibitors for the treatment of rheumatoid arthritis. Bioorg Med Chem Lett 21:6258-63 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Lyn
Name:Tyrosine-protein kinase Lyn
Synonyms:JTK8 | LYN | Lck/Yes-related novel protein tyrosine kinase | Tyrosine-protein kinase Lyn (LYN) | V-yes-1 Yamaguchi sarcoma viral related oncogene homolog | p53Lyn | p56Lyn
Type:Protein
Mol. Mass.:58575.92
Organism:Homo sapiens (Human)
Description:P07948
Residue:512
Sequence:
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50357312
n/a
NameBDBM50357312
Synonyms:IBRUTINIB | PCI-32765 | US10124003, Ref. Ex. Compound 1 | US9108973, Ref 1 | US9181263, 1 | US9278100, 1
TypeSmall organic molecule
Emp. Form.C25H24N6O2
Mol. Mass.440.4971
SMILESNc1ncnc2n(nc(-c3ccc(Oc4ccccc4)cc3)c12)[C@@H]1CCCN(C1)C(=O)C=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: