Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric Oxide Synthase, inducible
LigandBDBM50357557
Substrate/Competitorn/a
Meas. Tech.ChEMBL_787699
IC50 11700±n/a nM
Citation Shen LPark EJKondratyuk TPGuendisch DMarler LPezzuto JMWright ADSun D Design, synthesis, and biological evaluation of callophycin A and analogues as potential chemopreventive and anticancer agents. Bioorg Med Chem 19:6182-95 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric Oxide Synthase, inducible
Name:Nitric oxide synthase, inducible
Synonyms:Inducible NO synthase | Inducible NOS | Inducible nitric oxide synthase (iNOS) | MAC-NOS | Macrophage NOS | NOS type II | Nitric oxide synthase, inducible (iNOS)
Type:Enzyme
Mol. Mass.:130595.79
Organism:Mus musculus (mouse)
Description:Recombinant enzyme overexpressed in E. coli.
Residue:1144
Sequence:
MACPWKFLFKVKSYQSDLKEEKDINNNVKKTPCAVLSPTIQDDPKSHQNGSPQLLTGTAQ
NVPESLDKLHVTSTRPQYVRIKNWGSGEILHDTLHHKATSDFTCKSKSCLGSIMNPKSLT
RGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDEL
IFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITV
FPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLP
LVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEFPA
CPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINVAVLHSF
QKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNYVLS
PFYYYQIEPWKTHIWQNEKLRPRRREIRFRVLVKVVFFASMLMRKVMASRVRATVLFATE
TGKSEALARDLATLFSYAFNTKVVCMDQYKASTLEEEQLLLVVTSTFGNGDCPSNGQTLK
KSLFMLRELNHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSGQE
DAFRSWAVQTFRAACETFDVRSKHHIQIPKRFTSNATWEPQQYRLIQSPEPLDLNRALSS
IHAKNVFTMRLKSQQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIFPGNQTALVQG
ILERVVDCPTPHQTVCLEVLDESGSYWVKDKRLPPCSLSQALTYFLDITTPPTQLQLHKL
ARFATDETDRQRLEALCQPSEYNDWKFSNNPTFLEVLEEFPSLHVPAAFLLSQLPILKPR
YYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWIRNLKPQDPVPCFVRSVSG
FQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHKGLKGGRMSLVFGCRHPEEDHLYQ
EEMQEMVRKRVLFQVHTGYSRLPGKPKVYVQDILQKQLANEVLSVLHGEQGHLYICGDVR
MARDVATTLKKLVATKLNLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGAKKGSALEEPK
ATRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50357557
n/a
NameBDBM50357557
Synonyms:CHEMBL1915174
TypeSmall organic molecule
Emp. Form.C24H29N3O3
Mol. Mass.407.5054
SMILESCOC(=O)[C@H]1Cc2c(CN1C(=O)NC13CC4CC(CC(C4)C1)C3)[nH]c1ccccc21 |r,TLB:12:13:16.15.20:18,THB:14:15:18:22.13.21,14:13:16.15.20:18,21:13:16:20.19.18,21:19:16:22.14.13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: