Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase NEK6
LigandBDBM50358243
Substrate/Competitorn/a
Meas. Tech.ChEMBL_790776
IC50>100000±n/a nM
Citation Lai DYu Svan Ofwegen LTotzke FProksch PLin W 9,10-secosteroids, protein kinase inhibitors from the Chinese gorgonian Astrogorgia sp. Bioorg Med Chem 19:6873-80 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase NEK6
Name:Serine/threonine-protein kinase NEK6
Synonyms:NEK6
Type:PROTEIN
Mol. Mass.:35724.53
Organism:Homo sapiens (Human)
Description:ChEMBL_1446777
Residue:313
Sequence:
MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVY
KATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNI
VLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFI
TATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEM
AALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
QVAKQMHIWMSST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50358243
n/a
NameBDBM50358243
Synonyms:CHEMBL1922224
TypeSmall organic molecule
Emp. Form.C27H42O2
Mol. Mass.398.6212
SMILESCC(C)C\C=C\[C@@H](C)[C@H]1CC[C@H]2[C@H](CCc3cc(O)ccc3C)[C@@H](O)CC[C@]12C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: